PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0442s0250.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family MYB
Protein Properties Length: 443aa    MW: 49071.8 Da    PI: 7.2881
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0442s0250.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.56.2e-181461148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
         Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                            +g W++eEde+l+++++++G g+W+++++  g+ R++k+c++rw +yl
  SapurV1A.0442s0250.1.p 14 KGLWSPEEDEKLLNYITKHGLGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                            678*******************************************97 PP

2Myb_DNA-binding44.43.9e-1467110146
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
         Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                             rg+++++E+ l++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
  SapurV1A.0442s0250.1.p  67 RGAFSQQEENLIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                             89********************.*********.*********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-26664IPR009057Homeodomain-like
PROSITE profilePS5129424.959965IPR017930Myb domain
SuperFamilySSF466892.36E-2912108IPR009057Homeodomain-like
SMARTSM007174.9E-131363IPR001005SANT/Myb domain
PfamPF002499.9E-161461IPR001005SANT/Myb domain
CDDcd001671.17E-111761No hitNo description
Gene3DG3DSA:1.10.10.605.3E-2565116IPR009057Homeodomain-like
PROSITE profilePS5129420.12666116IPR017930Myb domain
SMARTSM007172.9E-1266114IPR001005SANT/Myb domain
PfamPF002494.7E-1367110IPR001005SANT/Myb domain
CDDcd001676.05E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 443 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLNYIT KHGLGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SQQEENLIIE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS CIKKKLRQRG  120
IDPNTHKSLS EVENDKEKQQ LTADKSNENV SIVPHELNLI EATILKPPAV SSRSSNVITT  180
NNNKDWSGGS NLTNAPPKQE IFLDRFGTSH ESSTTASCRP SDLMAYFPFQ KLDYKPVIGL  240
SMNPKLCYNP NSSSSEMISH EFNSSMTPPT VLPSVSASMF QTPICVKPSV SLPSDHNPTV  300
GSCDVNGVQN WEAGSFSNNV SGSNGSSSSI ELQSNANFFE SSAFSWGLAD CGKSSDEAHL  360
RSLENETGED IKWSEYLSTP FFLGSTIQNQ TSHHVYSEMK PETHFIAQGS STSWLQNQQA  420
SQPADIYTKD LQRLAVAFGQ SI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ8017490.0JQ801749.1 Populus tomentosa putative transcription factor (MYB216) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002319449.10.0hypothetical protein POPTR_0013s00290g
TrEMBLB9I6B70.0B9I6B7_POPTR; Uncharacterized protein
STRINGPOPTR_0013s00290.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.11e-124myb domain protein 61